User talk:Gerald Farinas/archive1

From Wikipedia, the free encyclopedia
Jump to navigation Jump to search
WIKIPEDIA ADMINISTRATOR TOOLS
HOMEGUIDELISTDISPUTEVFDRCCSDDELBLKIFDRFDVPCLEANNEWRFAREFPNAMWAREQ
18:59 UTC, Wednesday, 5 August
Holy Name Cathedral
Gerald Craig C. Farinas

Birthday: Friday, 21 January, 1983
Birthplace: Honolulu, Hawaii
Residence: Chicago, Illinois
Ancestry: Filipino, Finnish, Italian, Portuguese, Spanish
Religion: Roman Catholic
Politics: Liberal Republican

Contact Information

Website: Click here
Weblog: Click here
Email: Click here

Find me on AIM as StokedGFX!
Wikipedia
Holy Name Cross
E. L. Doctorow
"Writing is a socially acceptable
form of schizophrenia."
Wikipedia
Discussion Archive

Discussion Archive[edit]

Welcome to the Gerald Farinas Discussion Archive. This page catalogs discussion threads written by Wikipedia editors and readers in reference to articles written by Gerald. If you would like to add a comment, please post it on the active discussion page.


Great work![edit]


Filipino Americans[edit]

  • Hi! Really great work on the Filipino Americans article. I was wondering if you also know about the plight of some Filipinos who hide in America. I personally know someone who went "TNT" in the States but is now a legal citizen when that person married an American. Also, information about how Filipinos in the Philippines view America as the "land of milk and honey" might also be appropriate. :) seav 21:33, May 25, 2004 (UTC)

Airports[edit]

  • A category link and the text "An airport of the State of Hawai'i." doesn't even qualify as stub status. I deleted a couple, then noticed you made a bunch of them. I'll leave the rest to give you a chance to improve them (though someone else may delete them). You could start by at least mentioning where the airport is, and maybe wikilinking airport and Hawaii. Cheers, -- Infrogmation 22:09, 28 Jun 2004 (UTC)
  • I did minimal upgrade to Hana Airport as an example, adding wikilinks and a bit of info from what links there. I'd like to know where the airport is-- Hana, Hawaii, maybe? But I didn't want to guess. If you know where it is, please add that info. -- Infrogmation 22:14, 28 Jun 2004 (UTC)
  • Looks like you are doing great work filling in articles! Cheers, -- Infrogmation 17:10, 29 Jun 2004 (UTC)
  • Sorry, I made stubs of all the airports in Hawai'i expecting to fill them all in one sitting. Then I was unexpectedly whisked away for a day and couldn't complete them. I expanded most of them. Gerald Farinas 17:30, 29 Jun 2004 (UTC)

Education in Hawaii[edit]


LDS Temples[edit]


Democratic Convention Poll[edit]

  • Hello, I was wondering where you got the info on the poll about Bill and Hillary being the most popular democrats in the US.ChrisDJackson
  • I got it off a graphic they featured on the PBS coverage with Jim Lehrer. Bill Clinton was voted most popular, followed by John Kerry then Hillary Clinton. They even went on and on about how the poll indicated that if Kerry loses the election, Hillary Clinton "will be it for 2008." --Gerald Farinas 15:48, 28 Jul 2004 (UTC)

My Sincere Apologies[edit]

  • Aloha Gerald, I want to sincerely apologize for my being upset with my attempts at contributing and misunderstanding how and what to do. I did not want to cause any problems or create any anger amongst the Wikipedia community. It seems I overreacted to having my efforts edited. But I can see why and how. I do really think that you, along with everyone else that has contributed to the Hawaii Article has done a great job. I am sorry for any trouble I may have caused you. Very sorry for making it a racial issue. What do you think of the "Scenic Backdrop" section I have added? Is that something we should have on the Hawaii Article? I noticed New Zealand had their scenic backdrop as part of the New Zealand frontpage-touting the films made there like "Lord of the Rings". I am still learning how to contribute and have made a few mistakes in doing so. --Ilikea

Obama[edit]

  • Hi, I'm trying to work Barack Obama up to featured status. I wanted to say thanks for the photos; however, people often demand a source for them if used under fair use, as well as a justification; see Image:Them! DVD.jpg for a really good example. Can you remember where they were from, and justify? Thanks a lot, [[User:Meelar|Meelar (talk)]] 14:06, 2004 Aug 2 (UTC)
  • I appreciate it. Best, [[User:Meelar|Meelar (talk)]] 16:21, 2004 Aug 2 (UTC)

Father Damien[edit]

  • Gerald - Father Damien is the backup featured article. Should there be a problem with one of the featured articles I choose (the ones you see on the main page), Father Damien will be used instead. This means that it could go on the main page at any time. I don't normally inform the articles' authors about stuff like this, but since it looks like you care about the article, I thought I'd do you the courtesy of letting you know. →Raul654 00:35, Aug 3, 2004 (UTC)
  • That was thoughtful of you. Thank you. --Gerald Farinas 01:13, 3 Aug 2004 (UTC)

Alan Keyes[edit]

  • After reading the Alan Keyes article, I'm confused about whether the Illinois Republican Party is still considering him to run against Obama. It says the Party "was considering" (past tense) him but from other sources I read I thought they still were. Do you have some more recent info? Salasks 03:06, Aug 4, 2004 (UTC)
  • Sorry. That was a bad choice of tense. It's supposed to be "is considering." --Gerald Farinas 15:47, 4 Aug 2004 (UTC)

Judy Baar Topinka[edit]

  • Hi, thanks for all the work on Judy Baar Topinka. Anyway, regarding the image you uploaded Image:Judybaartopinka.jpg, only works of the federal government are public domain; I believe Illinois retains its copyright. Unless it says differently on the page where you got the picture, it's under copyright. Thanks, [[User:Meelar|Meelar (talk)]] 16:48, 2004 Aug 4 (UTC)
  • Duly noted and fixed! Thanks for the heads up. --Gerald Farinas 17:25, 4 Aug 2004 (UTC)

Complete revision of sovereignty page[edit]

  • Gerald, I have a vague memory of a sovereignty page that USED to be there that seemed fairly balanced to me. It seems to have been replaced by a pro-independence diatribe, written by you. I do wish that you'd put back the original, as I really DON'T want to have to spend hours teasing apart misleading generalities. You've completely erased any mention of the various Hawaiian groups and given the impression that all Hawaiians are united in an "independence now" stance. This is simply NOT true. All the surveys show that only a tiny percentage of ethnic Hawaiians want anything like independence; restitution, reservation status -- Ka Lahui solutions -- are much more popular. Perhaps even more popular than that is "I can't bother with politics, I'm working" and "wait and see". Your summary of the objections to independence is also seriously misleading -- setting up straw men that you can knock down easily. I have a feeling that a number of people put a fair bit of work into the old page, and it's sad that you feel you have to wipe it out. --Zora 10:40, 12 Aug 2004 (UTC)
  • I resent the accusation that I've completely destroyed an entire article. I don't believe I have completely erased a previous page. I started the Hawaiian sovereignty movement page from scratch (the edit history whould prove that) and don't remember there being any article covering the Hawaiian sovereignty movement previous to the one I wrote. If there are any problems with the way I wrote the article, then please make revisions you believe are needed. --Gerald Farinas 16:22, 13 Aug 2004 (UTC)
  • You're right and I APOLOGIZE. I just found Native Hawaiians on my watchlist again and realized that that was the article I was vaguely remembering. I will be working on the sovereignty article, but mainly to fill it out with names of various groups and summaries of the various positions. I imagine that if we bash it back and forth a few times we'll get something that might be NPOV. Again, I apologize. --Zora 20:13, 13 Aug 2004 (UTC)
  • Gerald, I stayed up till 4 AM to redo the sovereignty page. The page you had written was curiously abstract -- it had OHA, but no Ka Lahui, no Nation of Hawaii, etc. etc. I have brought it down to earth. Much of what I wrote was based on having lived through the events reported. I googled to check what I could, but there may be some mistakes. I'd have to go to the newspaper morgue to check more of it. I was involved in Green Party politics for a number of years, have met Haunani and Lilikala, etc., so I have a little more than a just "reading the newspaper" acquaintance with events. I moved the Wilcox and Home Rule party material you wrote to separate pages, but haven't edited it yet. I rather disagree with your view of Wilcox. I think he was self-serving sleaze. But I need to look at the primary sources; I might change my mind. You may be wondering what my own position is. It's hard to explain. I'm very much an anti-nationalist and I particularily deplore ethnic nationalism. Not only am I against a Hawaiian nation, I'm against a U.S. nation, an Israeli nation, a Palestinian nation, etc. I'd actually want something like the Ka Lahui proposal, but without the land base. I hope that none of that bled into the article, but if you see it, I suppose it's fair enough to root it out. I took out your POV, you can take out mine. --Zora 14:17, 16 Aug 2004 (UTC)

Falls of Clyde[edit]

  • I've done some serious damage ;-> to Falls of Clyde. Please look it over and see if I've deleted anything I shouldn't've. --the Epopt 05:15, 21 Aug 2004 (UTC)
Go back to Gerald Farinas main page by clicking here!